PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KXZ49574.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Chlorophyceae; Chlamydomonadales; Volvocaceae; Gonium
Family G2-like
Protein Properties Length: 526aa    MW: 52540.1 Da    PI: 8.8253
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KXZ49574.1genomeGPGRPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like86.62.5e-27369422155
     G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                 +prl+Wtp+LH++F +av++L G +kA+Pk+i++ m+++gLt+e+v+SHLQkYR+
  KXZ49574.1 369 RPRLVWTPQLHKKFESAVQKL-GVDKAVPKNIMQEMNIDGLTRENVASHLQKYRM 422
                 59*******************.********************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129410.076366425IPR017930Myb domain
SuperFamilySSF466891.34E-18367425IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.607.2E-27368425IPR009057Homeodomain-like
TIGRFAMsTIGR015574.5E-23370422IPR006447Myb domain, plants
PfamPF002498.5E-9372421IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0042753Biological Processpositive regulation of circadian rhythm
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 526 aa     Download sequence    Send to blast
MAYDASQALQ GFYGLKEDAS MDPAAGLVPL TSSLIPPLVA QAFGLPSLAS AAPPPPQPQV  60
QHPQASYASL MNPALMGAFG FGGGQYAAAV QQQSQLASLP LGYLQALAAA SQQQQQQQQQ  120
QQQQQQQTAA ALLHAHSAAL AAAARSAAAT SSAMSQPFMS APSADTCSGR AEPERAAATA  180
SAATNSSIPK PTPQHSFASS AGNGAAPYAQ NPLHSLYAAA ALAQQHAAYG AAAANPASGY  240
AAAMGPYSSG HLHSGYYARP PDANAALAAA AAAAAANRAY GYQAVQPGVG PYGGGFHPGY  300
GAPALDYAAL LAAYRPVAAP SMTAPSTMTG PQQSQSLGGP GPCAGAGGQG GAADEDNSAD  360
DGSTRAIKRP RLVWTPQLHK KFESAVQKLG VDKAVPKNIM QEMNIDGLTR ENVASHLQKY  420
RMLRRRDATS SEGRDSDTRT AGSKRSEPEP PRQQQPQPQA PAGAPAPAPA AAAGATQAAA  480
QAPAATLAQA PGTPSGGGTS AGEAPPPAAG AGAPQSAVTG SPTRAS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A5e-19366426262ARR10-B
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00014PBMTransfer from AT3G46640Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMap-Retrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A150GIC80.0A0A150GIC8_GONPE; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
ChlorophytaeOGCP1111645
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G46640.22e-26G2-like family protein